Lineage for d1e0td2 (1e0t D:1-69,D:168-344)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19439Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 19440Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 19441Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 19449Species Escherichia coli [TaxId:562] [51628] (3 PDB entries)
  8. 19453Domain d1e0td2: 1e0t D:1-69,D:168-344 [29295]
    Other proteins in same PDB: d1e0ta1, d1e0ta3, d1e0tb1, d1e0tb3, d1e0tc1, d1e0tc3, d1e0td1, d1e0td3

Details for d1e0td2

PDB Entry: 1e0t (more details), 1.8 Å

PDB Description: r292d mutant of e. coli pyruvate kinase
PDB Compounds: (D:)

SCOP Domain Sequences for d1e0td2:

Sequence, based on SEQRES records: (download)

>d1e0td2 c.1.12.1 (D:1-69,D:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli}
mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
aailldtkgXpalaekdkqdlifgceqgvdfvaasfirkrsdvieirehlkahggenihi
iskienqeglnnfdeileasdgimvargdlgveipveevifaqkmmiekcirarkvvita
tmmldsmiknprptdaeagdvanaildgtdavmlsgesakgkypleavsimaticertdr
vmnsrle

Sequence, based on observed residues (ATOM records): (download)

>d1e0td2 c.1.12.1 (D:1-69,D:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli}
mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
aailldtkgXpalaekdkqdlifgceqgvdfvaasfirkrsdvieirehlkahggenihi
iskienqeglnnfdeileasdgimvargdlgveipveevifaqkmmiekcirarkvvita
tmrptdaeagdvanaildgtdavmlsgepleavsimaticertdrvmnsrle

SCOP Domain Coordinates for d1e0td2:

Click to download the PDB-style file with coordinates for d1e0td2.
(The format of our PDB-style files is described here.)

Timeline for d1e0td2: