Lineage for d1e0tc2 (1e0t C:1-69,C:168-344)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475982Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 475983Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 475984Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 475992Species Escherichia coli [TaxId:562] [51628] (3 PDB entries)
  8. 475995Domain d1e0tc2: 1e0t C:1-69,C:168-344 [29294]
    Other proteins in same PDB: d1e0ta1, d1e0ta3, d1e0tb1, d1e0tb3, d1e0tc1, d1e0tc3, d1e0td1, d1e0td3

Details for d1e0tc2

PDB Entry: 1e0t (more details), 1.8 Å

PDB Description: r292d mutant of e. coli pyruvate kinase

SCOP Domain Sequences for d1e0tc2:

Sequence, based on SEQRES records: (download)

>d1e0tc2 c.1.12.1 (C:1-69,C:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli}
mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
aailldtkgXpalaekdkqdlifgceqgvdfvaasfirkrsdvieirehlkahggenihi
iskienqeglnnfdeileasdgimvargdlgveipveevifaqkmmiekcirarkvvita
tmmldsmiknprptdaeagdvanaildgtdavmlsgesakgkypleavsimaticertdr
vmnsrle

Sequence, based on observed residues (ATOM records): (download)

>d1e0tc2 c.1.12.1 (C:1-69,C:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli}
mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
aailldtkgXpalaekdkqdlifgceqgvdfvaasfirkrsdvieirehlkahggenihi
iskienqeglnnfdeileasdgimvargdlgveipveevifaqkmmiekcirarkvvita
tmrptdaeagdvanaildgtdavmlsgepleavsimaticertdrvmnsrle

SCOP Domain Coordinates for d1e0tc2:

Click to download the PDB-style file with coordinates for d1e0tc2.
(The format of our PDB-style files is described here.)

Timeline for d1e0tc2: