Lineage for d1e0tb2 (1e0t B:1-69,B:168-344)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088021Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2088022Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2088030Species Escherichia coli [TaxId:562] [51628] (3 PDB entries)
  8. 2088032Domain d1e0tb2: 1e0t B:1-69,B:168-344 [29293]
    Other proteins in same PDB: d1e0ta1, d1e0ta3, d1e0tb1, d1e0tb3, d1e0tc1, d1e0tc3, d1e0td1, d1e0td3
    complexed with so4; mutant

Details for d1e0tb2

PDB Entry: 1e0t (more details), 1.8 Å

PDB Description: r292d mutant of e. coli pyruvate kinase
PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d1e0tb2:

Sequence, based on SEQRES records: (download)

>d1e0tb2 c.1.12.1 (B:1-69,B:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]}
mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
aailldtkgXpalaekdkqdlifgceqgvdfvaasfirkrsdvieirehlkahggenihi
iskienqeglnnfdeileasdgimvargdlgveipveevifaqkmmiekcirarkvvita
tmmldsmiknprptdaeagdvanaildgtdavmlsgesakgkypleavsimaticertdr
vmnsrle

Sequence, based on observed residues (ATOM records): (download)

>d1e0tb2 c.1.12.1 (B:1-69,B:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]}
mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
aailldtkgXpalaekdkqdlifgceqgvdfvaasfirkrsdvieirehlkahggenihi
iskienqeglnnfdeileasdgimvargdlgveipveevifaqkmmiekcirarkvvita
tmrptdaeagdvanaildgtdavmlsgepleavsimaticertdrvmnsrle

SCOPe Domain Coordinates for d1e0tb2:

Click to download the PDB-style file with coordinates for d1e0tb2.
(The format of our PDB-style files is described here.)

Timeline for d1e0tb2: