SCOPe 2.03: Domain d1a3xb2: 1a3x B:1-87,B:189-366

Lineage for d1a3xb2 (1a3x B:1-87,B:189-366)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families)

5. Family c.1.12.1: Pyruvate kinase [51622] (1 protein)

6. Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
   this domain is interrupted by an all-beta domain
   C-terminal domain is alpha/beta

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51627] (2 PDB entries)

8. Domain d1a3xb2: 1a3x B:1-87,B:189-366 [29291]
   Other proteins in same PDB: d1a3xa1, d1a3xa3, d1a3xb1, d1a3xb3
   complexed with k, mn, pga

Details for d1a3xb2

PDB Entry: 1a3x, 3 Å

PDB Description: pyruvate kinase from saccharomyces cerevisiae complexed with pg, mn2+ and k+

PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d1a3xb2:

Sequence; same for both SEQRES and ATOM records:

>d1a3xb2 c.1.12.1 (B:1-87,B:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msrlerltslnvvagsdlrrtsiigtigpktnnpetlvalrkaglnivrmnfshgsyeyh
ksvidnarkseelypgrplaialdtkgXpalsekdkedlrfgvkngvhmvfasfirtand
vltirevlgeqgkdvkiivkienqqgvnnfdeilkvtdgvmvargdlgieipapevlavq
kkliaksnlagkpvicatqmlesmtynprptraevsdvgnaildgadcvmlsgetakgny
pinavttmaetaviaeqaiaylpnyd

Timeline for d1a3xb2:

• d1a3xb2 first appeared (with stable ids) in SCOP 1.55
  
• d1a3xb2 appears in SCOPe 2.02
  
• d1a3xb2 appears in SCOPe 2.04
  
• d1a3xb2 appears in the current release, SCOPe 2.08