Lineage for d1pkld2 (1pkl D:1-87,D:187-357)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475982Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 475983Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 475984Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 476022Species Leishmania mexicana [TaxId:5665] [51626] (1 PDB entry)
  8. 476026Domain d1pkld2: 1pkl D:1-87,D:187-357 [29283]
    Other proteins in same PDB: d1pkla1, d1pkla3, d1pklb1, d1pklb3, d1pklc1, d1pklc3, d1pkld1, d1pkld3, d1pkle1, d1pkle3, d1pklf1, d1pklf3, d1pklg1, d1pklg3, d1pklh1, d1pklh3

Details for d1pkld2

PDB Entry: 1pkl (more details), 2.35 Å

PDB Description: the structure of leishmania pyruvate kinase

SCOP Domain Sequences for d1pkld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkld2 c.1.12.1 (D:1-87,D:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana}
sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
qttinnvrqaaaelgvniaialdtkgpXpavsakdrvdlqfgveqgvdmifasfirsaeq
vgdvrkalgpkgrdimiickienhqgvqnidsiieesdgimvargdlgveipaekvvvaq
kiliskcnvagkpvicatqmlesmtynprptraevsdvanavfngadcvmlsgetakgky
pnevvqymaricleaqsal

SCOP Domain Coordinates for d1pkld2:

Click to download the PDB-style file with coordinates for d1pkld2.
(The format of our PDB-style files is described here.)

Timeline for d1pkld2: