Lineage for d1aqfe2 (1aqf E:12-115,E:218-395)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174373Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 174374Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 174375Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 174405Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (6 PDB entries)
  8. 174426Domain d1aqfe2: 1aqf E:12-115,E:218-395 [29276]
    Other proteins in same PDB: d1aqfa1, d1aqfa3, d1aqfb1, d1aqfb3, d1aqfc1, d1aqfc3, d1aqfd1, d1aqfd3, d1aqfe1, d1aqfe3, d1aqff1, d1aqff3, d1aqfg1, d1aqfg3, d1aqfh1, d1aqfh3

Details for d1aqfe2

PDB Entry: 1aqf (more details), 2.7 Å

PDB Description: pyruvate kinase from rabbit muscle with mg, k, and l-phospholactate
PDB Compounds: (E:)

SCOP Domain Sequences for d1aqfe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqfe2 c.1.12.1 (E:12-115,E:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus)}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOP Domain Coordinates for d1aqfe2:

Click to download the PDB-style file with coordinates for d1aqfe2.
(The format of our PDB-style files is described here.)

Timeline for d1aqfe2: