Lineage for d1aqfb2 (1aqf B:12-115,B:218-395)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1574300Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 1574301Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 1574302Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 1574340Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (7 PDB entries)
  8. 1574366Domain d1aqfb2: 1aqf B:12-115,B:218-395 [29273]
    Other proteins in same PDB: d1aqfa1, d1aqfa3, d1aqfb1, d1aqfb3, d1aqfc1, d1aqfc3, d1aqfd1, d1aqfd3, d1aqfe1, d1aqfe3, d1aqff1, d1aqff3, d1aqfg1, d1aqfg3, d1aqfh1, d1aqfh3
    complexed with k, mg, peq

Details for d1aqfb2

PDB Entry: 1aqf (more details), 2.7 Å

PDB Description: pyruvate kinase from rabbit muscle with mg, k, and l-phospholactate
PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d1aqfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqfb2 c.1.12.1 (B:12-115,B:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOPe Domain Coordinates for d1aqfb2:

Click to download the PDB-style file with coordinates for d1aqfb2.
(The format of our PDB-style files is described here.)

Timeline for d1aqfb2: