Lineage for d1aqfa2 (1aqf A:12-115,A:218-395)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117377Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 117378Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 117379Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 117409Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (6 PDB entries)
  8. 117426Domain d1aqfa2: 1aqf A:12-115,A:218-395 [29272]
    Other proteins in same PDB: d1aqfa1, d1aqfa3, d1aqfb1, d1aqfb3, d1aqfc1, d1aqfc3, d1aqfd1, d1aqfd3, d1aqfe1, d1aqfe3, d1aqff1, d1aqff3, d1aqfg1, d1aqfg3, d1aqfh1, d1aqfh3

Details for d1aqfa2

PDB Entry: 1aqf (more details), 2.7 Å

PDB Description: pyruvate kinase from rabbit muscle with mg, k, and l-phospholactate
PDB Compounds: (A:)

SCOP Domain Sequences for d1aqfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqfa2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus)}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOP Domain Coordinates for d1aqfa2:

Click to download the PDB-style file with coordinates for d1aqfa2.
(The format of our PDB-style files is described here.)

Timeline for d1aqfa2: