Lineage for d1a5ud2 (1a5u D:1812-1915,D:2018-2195)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2837914Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2837915Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2837968Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (7 PDB entries)
  8. 2837988Domain d1a5ud2: 1a5u D:1812-1915,D:2018-2195 [29266]
    Other proteins in same PDB: d1a5ua1, d1a5ua3, d1a5ub1, d1a5ub3, d1a5uc1, d1a5uc3, d1a5ud1, d1a5ud3, d1a5ue1, d1a5ue3, d1a5uf1, d1a5uf3, d1a5ug1, d1a5ug3, d1a5uh1, d1a5uh3
    complexed with atp, mg, na, oxl

Details for d1a5ud2

PDB Entry: 1a5u (more details), 2.35 Å

PDB Description: pyruvate kinase complex with bis mg-atp-na-oxalate
PDB Compounds: (D:) pyruvate kinase

SCOPe Domain Sequences for d1a5ud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5ud2 c.1.12.1 (D:1812-1915,D:2018-2195) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOPe Domain Coordinates for d1a5ud2:

Click to download the PDB-style file with coordinates for d1a5ud2.
(The format of our PDB-style files is described here.)

Timeline for d1a5ud2: