Lineage for d1a49d2 (1a49 D:1812-1915,D:2018-2195)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65575Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 65576Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 65577Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 65607Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (4 PDB entries)
  8. 65611Domain d1a49d2: 1a49 D:1812-1915,D:2018-2195 [29258]
    Other proteins in same PDB: d1a49a1, d1a49a3, d1a49b1, d1a49b3, d1a49c1, d1a49c3, d1a49d1, d1a49d3, d1a49e1, d1a49e3, d1a49f1, d1a49f3, d1a49g1, d1a49g3, d1a49h1, d1a49h3

Details for d1a49d2

PDB Entry: 1a49 (more details), 2.1 Å

PDB Description: bis mg-atp-k-oxalate complex of pyruvate kinase

SCOP Domain Sequences for d1a49d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a49d2 c.1.12.1 (D:1812-1915,D:2018-2195) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus)}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOP Domain Coordinates for d1a49d2:

Click to download the PDB-style file with coordinates for d1a49d2.
(The format of our PDB-style files is described here.)

Timeline for d1a49d2: