Lineage for d1pkm_2 (1pkm 12-115,218-395)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19439Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 19440Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 19441Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 19447Species Cat (Felis domestica) [TaxId:9685] [51624] (1 PDB entry)
  8. 19448Domain d1pkm_2: 1pkm 12-115,218-395 [29254]
    Other proteins in same PDB: d1pkm_1, d1pkm_3

Details for d1pkm_2

PDB Entry: 1pkm (more details), 2.6 Å

PDB Description: the refined three-dimensional structure of cat muscle (m1) pyruvate kinase, at a resolution of 2.6 angstroms

SCOP Domain Sequences for d1pkm_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkm_2 c.1.12.1 (12-115,218-395) Pyruvate kinase, N-terminal domain {Cat (Felis domestica)}
iqtqqlhaamadtflehmcrldidsppitarntgiictigpasrsveilkemiksgmnva
rlnfshgtheyhaetiknvraatesfasdpiryrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkasdvhevrkvlgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmmigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOP Domain Coordinates for d1pkm_2:

Click to download the PDB-style file with coordinates for d1pkm_2.
(The format of our PDB-style files is described here.)

Timeline for d1pkm_2: