Lineage for d1pkm_2 (1pkm 12-115,218-395)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) 
Family c.1.12.1: Pyruvate kinase [51622] (1 protein) Protein Pyruvate kinase, N-terminal domain [51623] (5 species) 
Species Cat (Felis domestica) [TaxId:9685] [51624] (1 PDB entry) 
Domain d1pkm_2: 1pkm 12-115,218-395 [29254]
Other proteins in same PDB: d1pkm_1, d1pkm_3
Details for d1pkm_2
PDB Entry: 1pkm (more details), 2.6 Å
PDB Description: the refined three-dimensional structure of cat muscle (m1) pyruvate kinase, at a resolution of 2.6 angstroms
SCOP Domain Sequences for d1pkm_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkm_2 c.1.12.1 (12-115,218-395) Pyruvate kinase, N-terminal domain {Cat (Felis domestica)}
iqtqqlhaamadtflehmcrldidsppitarntgiictigpasrsveilkemiksgmnva
rlnfshgtheyhaetiknvraatesfasdpiryrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkasdvhevrkvlgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmmigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe
SCOP Domain Coordinates for d1pkm_2:
Click to download the PDB-style file with coordinates for d1pkm_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pkm_2:
- d1pkm_2 appears in SCOP 1.57
- d1pkm_2 appears in the current release, SCOPe 2.08, called d1pkma2
View in 3D
