Lineage for d1chrb1 (1chr B:127-370)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19368Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 19390Family c.1.11.2: D-glucarate dehydratase-like [51609] (5 proteins)
  6. 19391Protein Chlormuconate cycloisomerase [51619] (1 species)
  7. 19392Species Alcaligenes eutrophus [TaxId:106590] [51620] (2 PDB entries)
  8. 19395Domain d1chrb1: 1chr B:127-370 [29253]
    Other proteins in same PDB: d1chra2, d1chrb2

Details for d1chrb1

PDB Entry: 1chr (more details), 3 Å

PDB Description: crystal structure of chloromuconate cycloisomerase from alcaligenes eutrophus jmp134 (pjp4) at 3 angstroms resolution

SCOP Domain Sequences for d1chrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chrb1 c.1.11.2 (B:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus}
plrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmealsnslg
skaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrvaimade
slstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmldstigts
valqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtldedkvrqy
arvs

SCOP Domain Coordinates for d1chrb1:

Click to download the PDB-style file with coordinates for d1chrb1.
(The format of our PDB-style files is described here.)

Timeline for d1chrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1chrb2