Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein Chlormuconate cycloisomerase [51619] (2 species) |
Species Alcaligenes eutrophus [TaxId:106590] [51620] (1 PDB entry) |
Domain d2chra1: 2chr A:127-370 [29251] Other proteins in same PDB: d2chra2 complexed with cl, mn |
PDB Entry: 2chr (more details), 3 Å
SCOPe Domain Sequences for d2chra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} plrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmealsnslg skaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrvaimade slstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmldstigts valqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtldedkvrqy arvs
Timeline for d2chra1: