Lineage for d2chr_1 (2chr 127-370)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386021Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this family
  5. 386061Family c.1.11.2: D-glucarate dehydratase-like [51609] (8 proteins)
  6. 386073Protein Chlormuconate cycloisomerase [51619] (2 species)
  7. 386074Species Alcaligenes eutrophus [TaxId:106590] [51620] (2 PDB entries)
  8. 386075Domain d2chr_1: 2chr 127-370 [29251]
    Other proteins in same PDB: d2chr_2
    complexed with cl, mn

Details for d2chr_1

PDB Entry: 2chr (more details), 3 Å

PDB Description: a re-evaluation of the crystal structure of chloromuconate cycloisomerase
PDB Compounds: ( :)

SCOP Domain Sequences for d2chr_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chr_1 c.1.11.2 (127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus}
plrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmealsnslg
skaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrvaimade
slstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmldstigts
valqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtldedkvrqy
arvs

SCOP Domain Coordinates for d2chr_1:

Click to download the PDB-style file with coordinates for d2chr_1.
(The format of our PDB-style files is described here.)

Timeline for d2chr_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2chr_2