SCOP 1.67: Domain d2chr_1: 2chr 127-370

Lineage for d2chr_1 (2chr 127-370)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this family

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (8 proteins)

6. Protein Chlormuconate cycloisomerase [51619] (2 species)

7. Species Alcaligenes eutrophus [TaxId:106590] [51620] (2 PDB entries)

8. Domain d2chr_1: 2chr 127-370 [29251]
   Other proteins in same PDB: d2chr_2
   complexed with cl, mn

Details for d2chr_1

PDB Entry: 2chr, 3 Å

PDB Description: a re-evaluation of the crystal structure of chloromuconate cycloisomerase

SCOP Domain Sequences for d2chr_1:

Sequence; same for both SEQRES and ATOM records:

>d2chr_1 c.1.11.2 (127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus}
plrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmealsnslg
skaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrvaimade
slstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmldstigts
valqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtldedkvrqy
arvs

Timeline for d2chr_1:

• d2chr_1 first appeared (with stable ids) in SCOP 1.55
  
• d2chr_1 appears in SCOP 1.65
  
• d2chr_1 appears in SCOP 1.69
  
• d2chr_1 appears in the current release, SCOPe 2.08, called d2chra1