Lineage for d1dtn_1 (1dtn 133-359)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19368Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 19390Family c.1.11.2: D-glucarate dehydratase-like [51609] (5 proteins)
  6. 19416Protein Mandelate racemase [51617] (1 species)
  7. 19417Species Pseudomonas putida [TaxId:303] [51618] (6 PDB entries)
  8. 19422Domain d1dtn_1: 1dtn 133-359 [29249]
    Other proteins in same PDB: d1dtn_2

Details for d1dtn_1

PDB Entry: 1dtn (more details), 2.1 Å

PDB Description: mandelate racemase mutant d270n co-crystallized with (s)-atrolactate
PDB Compounds: ( :)

SCOP Domain Sequences for d1dtn_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtn_1 c.1.11.2 (133-359) Mandelate racemase {Pseudomonas putida}
pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlqrldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv

SCOP Domain Coordinates for d1dtn_1:

Click to download the PDB-style file with coordinates for d1dtn_1.
(The format of our PDB-style files is described here.)

Timeline for d1dtn_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dtn_2