Lineage for d1mdl_1 (1mdl 133-359)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572967Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 573010Family c.1.11.2: D-glucarate dehydratase-like [51609] (11 proteins)
  6. 573078Protein Mandelate racemase [51617] (1 species)
  7. 573079Species Pseudomonas putida [TaxId:303] [51618] (6 PDB entries)
  8. 573082Domain d1mdl_1: 1mdl 133-359 [29247]
    Other proteins in same PDB: d1mdl_2
    complexed with mg, rmn, smn; mutant

Details for d1mdl_1

PDB Entry: 1mdl (more details), 1.85 Å

PDB Description: mandelate racemase mutant k166r co-crystallized with (r)-mandelate

SCOP Domain Sequences for d1mdl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdl_1 c.1.11.2 (133-359) Mandelate racemase {Pseudomonas putida}
pvqaydshsldgvklateravtaaelgfravktrigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv

SCOP Domain Coordinates for d1mdl_1:

Click to download the PDB-style file with coordinates for d1mdl_1.
(The format of our PDB-style files is described here.)

Timeline for d1mdl_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mdl_2