Lineage for d1mdl_1 (1mdl 133-359)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) 
Family c.1.11.2: D-glucarate dehydratase-like [51609] (5 proteins) 
Protein Mandelate racemase [51617] (1 species) Species Pseudomonas putida [TaxId:303] [51618] (6 PDB entries) 
Domain d1mdl_1: 1mdl 133-359 [29247]
Other proteins in same PDB: d1mdl_2
Details for d1mdl_1
PDB Entry: 1mdl (more details), 1.85 Å
PDB Description: mandelate racemase mutant k166r co-crystallized with (r)-mandelate
SCOP Domain Sequences for d1mdl_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdl_1 c.1.11.2 (133-359) Mandelate racemase {Pseudomonas putida}
pvqaydshsldgvklateravtaaelgfravktrigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv
SCOP Domain Coordinates for d1mdl_1:
Click to download the PDB-style file with coordinates for d1mdl_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mdl_1:
- d1mdl_1 first appeared (with stable ids) in SCOP 1.55
- d1mdl_1 appears in SCOP 1.59
- d1mdl_1 appears in the current release, SCOPe 2.08, called d1mdla1
View in 3D
