Lineage for d1mns_1 (1mns 133-359)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475826Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this family
  5. 475869Family c.1.11.2: D-glucarate dehydratase-like [51609] (9 proteins)
  6. 475933Protein Mandelate racemase [51617] (1 species)
  7. 475934Species Pseudomonas putida [TaxId:303] [51618] (6 PDB entries)
  8. 475936Domain d1mns_1: 1mns 133-359 [29246]
    Other proteins in same PDB: d1mns_2

Details for d1mns_1

PDB Entry: 1mns (more details), 2 Å

PDB Description: on the role of lysine 166 in the mechanism of mandelate racemase from pseudomonas putida: mechanistic and crystallographic evidence for stereospecific alkylation by (r)-alpha-phenylglycidate

SCOP Domain Sequences for d1mns_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mns_1 c.1.11.2 (133-359) Mandelate racemase {Pseudomonas putida}
pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv

SCOP Domain Coordinates for d1mns_1:

Click to download the PDB-style file with coordinates for d1mns_1.
(The format of our PDB-style files is described here.)

Timeline for d1mns_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mns_2