Lineage for d2mnra1 (2mnr A:133-359)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2099101Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2099187Protein Mandelate racemase [51617] (3 species)
  7. 2099202Species Pseudomonas putida [TaxId:303] [51618] (6 PDB entries)
  8. 2099203Domain d2mnra1: 2mnr A:133-359 [29245]
    Other proteins in same PDB: d2mnra2
    complexed with mn, so4

Details for d2mnra1

PDB Entry: 2mnr (more details), 1.9 Å

PDB Description: mechanism of the reaction catalyzed by mandelate racemase. 2. crystal structure of mandelate racemase at 2.5 angstroms resolution: identification of the active site and possible catalytic residues
PDB Compounds: (A:) mandelate racemase

SCOPe Domain Sequences for d2mnra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]}
pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv

SCOPe Domain Coordinates for d2mnra1:

Click to download the PDB-style file with coordinates for d2mnra1.
(The format of our PDB-style files is described here.)

Timeline for d2mnra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mnra2