Lineage for d2mucb1 (2muc B:131-372)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19368Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 19390Family c.1.11.2: D-glucarate dehydratase-like [51609] (5 proteins)
  6. 19424Protein Muconate-lactonizing enzyme [51615] (1 species)
  7. 19425Species Pseudomonas putida [TaxId:303] [51616] (4 PDB entries)
  8. 19432Domain d2mucb1: 2muc B:131-372 [29242]
    Other proteins in same PDB: d2muca2, d2mucb2

Details for d2mucb1

PDB Entry: 2muc (more details), 2.3 Å

PDB Description: muconate cycloisomerase variant f329i
PDB Compounds: (B:)

SCOP Domain Sequences for d2mucb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mucb1 c.1.11.2 (B:131-372) Muconate-lactonizing enzyme {Pseudomonas putida}
rvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelg
dsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimade
siesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtl
asahafltlrqltwgteligplllteeivneppqyrdfqlhiprtpglgltldeqrlarf
ar

SCOP Domain Coordinates for d2mucb1:

Click to download the PDB-style file with coordinates for d2mucb1.
(The format of our PDB-style files is described here.)

Timeline for d2mucb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mucb2