Lineage for d1bkhc1 (1bkh C:131-372)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19368Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 19390Family c.1.11.2: D-glucarate dehydratase-like [51609] (5 proteins)
  6. 19424Protein Muconate-lactonizing enzyme [51615] (1 species)
  7. 19425Species Pseudomonas putida [TaxId:303] [51616] (4 PDB entries)
  8. 19430Domain d1bkhc1: 1bkh C:131-372 [29240]
    Other proteins in same PDB: d1bkha2, d1bkhb2, d1bkhc2

Details for d1bkhc1

PDB Entry: 1bkh (more details), 2.1 Å

PDB Description: muconate lactonizing enzyme from pseudomonas putida
PDB Compounds: (C:)

SCOP Domain Sequences for d1bkhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkhc1 c.1.11.2 (C:131-372) Muconate-lactonizing enzyme {Pseudomonas putida}
rvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelg
dsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimade
siesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtl
asahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarf
ar

SCOP Domain Coordinates for d1bkhc1:

Click to download the PDB-style file with coordinates for d1bkhc1.
(The format of our PDB-style files is described here.)

Timeline for d1bkhc1: