Lineage for d1muca1 (1muc A:131-372)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65496Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 65518Family c.1.11.2: D-glucarate dehydratase-like [51609] (5 proteins)
  6. 65558Protein Muconate-lactonizing enzyme [51615] (1 species)
  7. 65559Species Pseudomonas putida [TaxId:303] [51616] (5 PDB entries)
  8. 65560Domain d1muca1: 1muc A:131-372 [29236]
    Other proteins in same PDB: d1muca2, d1mucb2

Details for d1muca1

PDB Entry: 1muc (more details), 1.85 Å

PDB Description: structure of muconate lactonizing enzyme at 1.85 angstroms resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1muca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida}
rvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelg
dsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimade
siesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtl
asahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarf
ar

SCOP Domain Coordinates for d1muca1:

Click to download the PDB-style file with coordinates for d1muca1.
(The format of our PDB-style files is described here.)

Timeline for d1muca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1muca2