| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
| Protein Muconate-lactonizing enzyme [51615] (1 species) |
| Species Pseudomonas putida [TaxId:303] [51616] (5 PDB entries) |
| Domain d1muca1: 1muc A:131-372 [29236] Other proteins in same PDB: d1muca2, d1mucb2 complexed with mn |
PDB Entry: 1muc (more details), 1.85 Å
SCOPe Domain Sequences for d1muca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]}
rvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelg
dsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimade
siesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtl
asahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarf
ar
Timeline for d1muca1: