Lineage for d1fhva1 (1fhv A:100-320)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386021Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this family
  5. 386061Family c.1.11.2: D-glucarate dehydratase-like [51609] (8 proteins)
  6. 386138Protein O-succinylbenzoate synthase [51613] (1 species)
  7. 386139Species Escherichia coli [TaxId:562] [51614] (3 PDB entries)
  8. 386142Domain d1fhva1: 1fhv A:100-320 [29235]
    Other proteins in same PDB: d1fhva2
    complexed with mg, osb

Details for d1fhva1

PDB Entry: 1fhv (more details), 1.77 Å

PDB Description: crystal structure analysis of o-succinylbenzoate synthase from e. coli complexed with mg and osb

SCOP Domain Sequences for d1fhva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhva1 c.1.11.2 (A:100-320) O-succinylbenzoate synthase {Escherichia coli}
qaanyraaplcngdpddlilkladmpgekvakvkvglyeavrdgmvvnllleaipdlhlr
ldanrawtplkgqqfakyvnpdyrdriafleepcktrddsrafaretgiaiawdeslrep
dfafvaeegvravvikptltgslekvreqvqaahalgltavisssiesslgltqlariaa
wltpdtipgldtldlmqaqqvrrwpgstlpvvevdalerll

SCOP Domain Coordinates for d1fhva1:

Click to download the PDB-style file with coordinates for d1fhva1.
(The format of our PDB-style files is described here.)

Timeline for d1fhva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fhva2