Lineage for d1ecqb1 (1ecq B:138-446)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) 
binds metal ion (magnesium or manganese) in conserved site inside barrel
N-terminal alpha+beta domain is common to this superfamily
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) 
Protein D-glucarate dehydratase [51610] (2 species) Species Escherichia coli [TaxId:562] [51612] (7 PDB entries) 
Domain d1ecqb1: 1ecq B:138-446 [29231]
Other proteins in same PDB: d1ecqa2, d1ecqb2, d1ecqc2, d1ecqd2
complexed with dxg, ipa, mg
Details for d1ecqb1
PDB Entry: 1ecq (more details), 2 Å
PDB Description: e. coli glucarate dehydratase bound to 4-deoxyglucarate
PDB Compounds: (B:) glucarate dehydrataseSCOPe Domain Sequences for d1ecqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ecqb1 c.1.11.2 (B:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
dgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtpdavvrlaeaaye
kygfndfklkggvlageeeaesivalaqrfpqaritldpngawslneaikigkylkgsla
yaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslqsvdipladphfw
tmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitaidthwiwqegnqr
ltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgarddamgmqylipgwtf
dnkrpcmvr
SCOPe Domain Coordinates for d1ecqb1:
Click to download the PDB-style file with coordinates for d1ecqb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ecqb1:
View in 3D
