Lineage for d1ec9d1 (1ec9 D:138-446)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65496Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 65518Family c.1.11.2: D-glucarate dehydratase-like [51609] (5 proteins)
  6. 65524Protein D-glucarate dehydratase [51610] (2 species)
  7. 65525Species Escherichia coli [TaxId:562] [51612] (6 PDB entries)
  8. 65537Domain d1ec9d1: 1ec9 D:138-446 [29229]
    Other proteins in same PDB: d1ec9a2, d1ec9b2, d1ec9c2, d1ec9d2

Details for d1ec9d1

PDB Entry: 1ec9 (more details), 2 Å

PDB Description: e. coli glucarate dehydratase bound to xylarohydroxamate

SCOP Domain Sequences for d1ec9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec9d1 c.1.11.2 (D:138-446) D-glucarate dehydratase {Escherichia coli}
dgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtpdavvrlaeaaye
kygfndfklkggvlageeeaesivalaqrfpqaritldpngawslneaikigkylkgsla
yaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslqsvdipladphfw
tmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitaidthwiwqegnqr
ltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgarddamgmqylipgwtf
dnkrpcmvr

SCOP Domain Coordinates for d1ec9d1:

Click to download the PDB-style file with coordinates for d1ec9d1.
(The format of our PDB-style files is described here.)

Timeline for d1ec9d1: