Lineage for d1bqg_1 (1bqg 144-422)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19368Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 19390Family c.1.11.2: D-glucarate dehydratase-like [51609] (5 proteins)
  6. 19396Protein D-glucarate dehydratase [51610] (2 species)
  7. 19414Species Pseudomonas putida [TaxId:303] [51611] (1 PDB entry)
  8. 19415Domain d1bqg_1: 1bqg 144-422 [29217]
    Other proteins in same PDB: d1bqg_2

Details for d1bqg_1

PDB Entry: 1bqg (more details), 2.3 Å

PDB Description: the structure of the d-glucarate dehydratase protein from pseudomonas putida

SCOP Domain Sequences for d1bqg_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqg_1 c.1.11.2 (144-422) D-glucarate dehydratase {Pseudomonas putida}
egqqrdavemlgylfyvgdrnktdlgyrseheadnewfrlrnkealtpesvvalaeaayd
rygfkdfklkggvlrgedeiaavtalserfpdaritldpngawslkeavalcrdqhhvla
yaedpcgaengysgrevmaefrrstglrtatnmiatdwrqmghaiqlqsvdipladphfw
tmqgsvrvaqmcnewgltwgshsnnhfdislamfthvaaaapgnitaidthwiwqdgqrl
tkeplqikgglvevpkkpglgveldwdalmkahevyksm

SCOP Domain Coordinates for d1bqg_1:

Click to download the PDB-style file with coordinates for d1bqg_1.
(The format of our PDB-style files is described here.)

Timeline for d1bqg_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqg_2