Lineage for d1pdy_1 (1pdy 140-433)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) 
Family c.1.11.1: Enolase [51605] (1 protein) Protein Enolase [51606] (2 species) 
Species Lobster (Homarus vulgaris) [51608] (2 PDB entries) 
Domain d1pdy_1: 1pdy 140-433 [29216]
Other proteins in same PDB: d1pdy_2
Details for d1pdy_1
PDB Entry: 1pdy (more details), 2.4 Å
PDB Description: x-ray structure and catalytic mechanism of lobster enolase
SCOP Domain Sequences for d1pdy_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdy_1 c.1.11.1 (140-433) Enolase {Lobster (Homarus vulgaris)}
devilpvpafnvinggshagnklamqefmilptgatsfteamrmgtevyhhlkavikarf
gldatavgdeggfapnilnnkdaldliqeaikkagytgkieigmdvaasefykqnniydl
dfktanndgsqkisgdqlrdmymefckdfpivsiedpfdqddwetwskmtsgttiqivgd
dltvtnpkrittavekkackclllkvnqigsvtesidahllakkngwgtmvshrsgeted
cfiadlvvglctgqiktgapcrserlakynqilrieeelgsgakfagknfraps
SCOP Domain Coordinates for d1pdy_1:
Click to download the PDB-style file with coordinates for d1pdy_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pdy_1:
- d1pdy_1 appears in SCOP 1.57
- d1pdy_1 appears in the current release, SCOPe 2.08, called d1pdya1
View in 3D
