Lineage for d1pdz_1 (1pdz 140-433)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65496Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 65497Family c.1.11.1: Enolase [51605] (1 protein)
  6. 65498Protein Enolase [51606] (2 species)
  7. 65515Species Lobster (Homarus vulgaris) [51608] (2 PDB entries)
  8. 65516Domain d1pdz_1: 1pdz 140-433 [29215]
    Other proteins in same PDB: d1pdz_2

Details for d1pdz_1

PDB Entry: 1pdz (more details), 2.2 Å

PDB Description: x-ray structure and catalytic mechanism of lobster enolase

SCOP Domain Sequences for d1pdz_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdz_1 c.1.11.1 (140-433) Enolase {Lobster (Homarus vulgaris)}
devilpvpafnvinggshagnklamqefmilptgatsfteamrmgtevyhhlkavikarf
gldatavgdeggfapnilnnkdaldliqeaikkagytgkieigmdvaasefykqnniydl
dfktanndgsqkisgdqlrdmymefckdfpivsiedpfdqddwetwskmtsgttiqivgd
dltvtnpkrittavekkackclllkvnqigsvtesidahllakkngwgtmvshrsgeted
cfiadlvvglctgqiktgapcrserlakynqilrieeelgsgakfagknfraps

SCOP Domain Coordinates for d1pdz_1:

Click to download the PDB-style file with coordinates for d1pdz_1.
(The format of our PDB-style files is described here.)

Timeline for d1pdz_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pdz_2