Lineage for d1nel_1 (1nel 142-436)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) 
Family c.1.11.1: Enolase [51605] (1 protein) Protein Enolase [51606] (2 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (11 PDB entries) 
Domain d1nel_1: 1nel 142-436 [29214]
Other proteins in same PDB: d1nel_2
Details for d1nel_1
PDB Entry: 1nel (more details), 2.6 Å
PDB Description: fluoride inhibition of yeast enolase: crystal structure of the enolase-mg2+-f--pi complex at 2.6-angstroms resolution
SCOP Domain Sequences for d1nel_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nel_1 c.1.11.1 (142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl
SCOP Domain Coordinates for d1nel_1:
Click to download the PDB-style file with coordinates for d1nel_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nel_1:
- d1nel_1 appears in SCOP 1.57
- d1nel_1 appears in the current release, SCOPe 2.08, called d1nela1
View in 3D
