Lineage for d7enl_1 (7enl 142-436)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19368Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 19369Family c.1.11.1: Enolase [51605] (1 protein)
  6. 19370Protein Enolase [51606] (2 species)
  7. 19371Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (11 PDB entries)
  8. 19384Domain d7enl_1: 7enl 142-436 [29212]
    Other proteins in same PDB: d7enl_2

Details for d7enl_1

PDB Entry: 7enl (more details), 2.2 Å

PDB Description: mechanism of enolase: the crystal structure of enolase-mg2+- phosphoglycerate(slash) phosphoenolpyruvate complex at 2.2-angstroms resolution

SCOP Domain Sequences for d7enl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7enl_1 c.1.11.1 (142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOP Domain Coordinates for d7enl_1:

Click to download the PDB-style file with coordinates for d7enl_1.
(The format of our PDB-style files is described here.)

Timeline for d7enl_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7enl_2