Lineage for d1ebha1 (1ebh A:142-436)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117274Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 117275Family c.1.11.1: Enolase [51605] (1 protein)
  6. 117276Protein Enolase [51606] (3 species)
  7. 117277Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (11 PDB entries)
  8. 117283Domain d1ebha1: 1ebh A:142-436 [29205]
    Other proteins in same PDB: d1ebha2, d1ebhb2

Details for d1ebha1

PDB Entry: 1ebh (more details), 1.9 Å

PDB Description: octahedral coordination at the high affinity metal site in enolase; crystallographic analysis of the mg++-enzyme from yeast at 1.9 angstroms resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1ebha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebha1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOP Domain Coordinates for d1ebha1:

Click to download the PDB-style file with coordinates for d1ebha1.
(The format of our PDB-style files is described here.)

Timeline for d1ebha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ebha2