| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
| Protein Enolase [51606] (10 species) Fold of this protein slightly differs from common fold in topology |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (16 PDB entries) |
| Domain d2onea1: 2one A:142-436 [29203] Other proteins in same PDB: d2onea2, d2oneb2 complexed with 2pg, li, mg, pep |
PDB Entry: 2one (more details), 2 Å
SCOPe Domain Sequences for d2onea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onea1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl
Timeline for d2onea1: