Lineage for d2onea1 (2one A:142-436)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65496Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 65497Family c.1.11.1: Enolase [51605] (1 protein)
  6. 65498Protein Enolase [51606] (2 species)
  7. 65499Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (11 PDB entries)
  8. 65503Domain d2onea1: 2one A:142-436 [29203]
    Other proteins in same PDB: d2onea2, d2oneb2

Details for d2onea1

PDB Entry: 2one (more details), 2 Å

PDB Description: asymmetric yeast enolase dimer complexed with resolved 2'-phosphoglycerate and phosphoenolpyruvate
PDB Compounds: (A:)

SCOP Domain Sequences for d2onea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onea1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOP Domain Coordinates for d2onea1:

Click to download the PDB-style file with coordinates for d2onea1.
(The format of our PDB-style files is described here.)

Timeline for d2onea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2onea2