SCOPe 2.02: Domain d1onea1: 1one A:142-436

Lineage for d1onea1 (1one A:142-436)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (1 protein)

6. Protein Enolase [51606] (8 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (16 PDB entries)

8. Domain d1onea1: 1one A:142-436 [29200]
   Other proteins in same PDB: d1onea2, d1oneb2
   complexed with mg, pep

Details for d1onea1

PDB Entry: 1one, 1.8 Å

PDB Description: yeast enolase complexed with an equilibrium mixture of 2'-phosphoglyceate and phosphoenolpyruvate

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d1onea1:

Sequence; same for both SEQRES and ATOM records:

>d1onea1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

Timeline for d1onea1:

• d1onea1 first appeared (with stable ids) in SCOP 1.55
  
• d1onea1 appears in SCOPe 2.01
  
• d1onea1 appears in SCOPe 2.03
  
• d1onea1 appears in the current release, SCOPe 2.08