Lineage for d1gg0a_ (1gg0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086072Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2086149Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (4 species)
  7. 2086245Species Escherichia coli [TaxId:562] [51603] (10 PDB entries)
    Uniprot P17579
  8. 2086253Domain d1gg0a_: 1gg0 A: [29199]
    complexed with po4

Details for d1gg0a_

PDB Entry: 1gg0 (more details), 3 Å

PDB Description: crystal structure analysis of kdop synthase at 3.0 a
PDB Compounds: (A:) 3-deoxy-d-manno-octulosonate 8-phosphate synthase

SCOPe Domain Sequences for d1gg0a_:

Sequence, based on SEQRES records: (download)

>d1gg0a_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Escherichia coli [TaxId: 562]}
mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
mlgfsimkkvsgnspvifdvthalqcrdpfgaasggrraqvaelaragmavglaglfiea
hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk

Sequence, based on observed residues (ATOM records): (download)

>d1gg0a_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Escherichia coli [TaxId: 562]}
mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
mlgfsimkkvsgnspvifdvthalqcrrraqvaelaragmavglaglfieahpdpehakc
dgpsalplaklepflkqmkaiddlvkgfeeldtsk

SCOPe Domain Coordinates for d1gg0a_:

Click to download the PDB-style file with coordinates for d1gg0a_.
(The format of our PDB-style files is described here.)

Timeline for d1gg0a_: