Lineage for d1d9ed_ (1d9e D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65283Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 65459Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 65470Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (2 species)
  7. 65488Species Escherichia coli [TaxId:562] [51603] (4 PDB entries)
  8. 65492Domain d1d9ed_: 1d9e D: [29198]

Details for d1d9ed_

PDB Entry: 1d9e (more details), 2.4 Å

PDB Description: structure of e. coli kdo8p synthase

SCOP Domain Sequences for d1d9ed_:

Sequence, based on SEQRES records: (download)

>d1d9ed_ c.1.10.4 (D:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Escherichia coli}
mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
mlgfsimkkvsgnspvifdvthalqcrdpfgaasggrraqvaelaragmavglaglfiea
hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk

Sequence, based on observed residues (ATOM records): (download)

>d1d9ed_ c.1.10.4 (D:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Escherichia coli}
mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
mlgfsimkkvsgnspvifdvthalqraqvaelaragmavglaglfieahpdpsalplakl
epflkqmkaiddlvkgfeeldtsk

SCOP Domain Coordinates for d1d9ed_:

Click to download the PDB-style file with coordinates for d1d9ed_.
(The format of our PDB-style files is described here.)

Timeline for d1d9ed_: