Lineage for d1d9ec_ (1d9e C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19200Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 19350Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 19361Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (1 species)
  7. 19362Species Escherichia coli [TaxId:562] [51603] (2 PDB entries)
  8. 19365Domain d1d9ec_: 1d9e C: [29197]

Details for d1d9ec_

PDB Entry: 1d9e (more details), 2.4 Å

PDB Description: structure of e. coli kdo8p synthase

SCOP Domain Sequences for d1d9ec_:

Sequence, based on SEQRES records: (download)

>d1d9ec_ c.1.10.4 (C:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Escherichia coli}
mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
mlgfsimkkvsgnspvifdvthalqcrdpfgaasggrraqvaelaragmavglaglfiea
hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk

Sequence, based on observed residues (ATOM records): (download)

>d1d9ec_ c.1.10.4 (C:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Escherichia coli}
mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
mlgfsimkkvsgnspvifdvthalqraqvaelaragmavglaglfieahpdpepsalpla
klepflkqmkaiddlvkgfeeldtsk

SCOP Domain Coordinates for d1d9ec_:

Click to download the PDB-style file with coordinates for d1d9ec_.
(The format of our PDB-style files is described here.)

Timeline for d1d9ec_: