Lineage for d1gg1d_ (1gg1 D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65283Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 65459Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 65460Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (1 species)
  7. 65461Species Escherichia coli [TaxId:562] [51601] (2 PDB entries)
  8. 65465Domain d1gg1d_: 1gg1 D: [29190]

Details for d1gg1d_

PDB Entry: 1gg1 (more details), 2 Å

PDB Description: crystal structure analysis of dahp synthase in complex with mn2+ and 2-phosphoglycolate

SCOP Domain Sequences for d1gg1d_:

Sequence, based on SEQRES records: (download)

>d1gg1d_ c.1.10.4 (D:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli}
lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
gnqslesgeplaygksitdacigwedtdallrqlanavkarrg

Sequence, based on observed residues (ATOM records): (download)

>d1gg1d_ c.1.10.4 (D:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli}
lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
gnqsleplaygksitdacigwedtdallrqlanavkarrg

SCOP Domain Coordinates for d1gg1d_:

Click to download the PDB-style file with coordinates for d1gg1d_.
(The format of our PDB-style files is described here.)

Timeline for d1gg1d_: