Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) |
Superfamily c.1.10: Aldolase [51569] (4 families) |
Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins) |
Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (1 species) |
Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (3 PDB entries) |
Domain d1gg1b_: 1gg1 B: [29188] |
PDB Entry: 1gg1 (more details), 2 Å
SCOP Domain Sequences for d1gg1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gg1b_ c.1.10.4 (B:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme} lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve gnqslesgeplaygksitdacigwedtdallrqlanavkarrg
Timeline for d1gg1b_: