Lineage for d1gg1b_ (1gg1 B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174007Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 174217Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 174218Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (1 species)
  7. 174219Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (3 PDB entries)
  8. 174221Domain d1gg1b_: 1gg1 B: [29188]

Details for d1gg1b_

PDB Entry: 1gg1 (more details), 2 Å

PDB Description: crystal structure analysis of dahp synthase in complex with mn2+ and 2-phosphoglycolate

SCOP Domain Sequences for d1gg1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gg1b_ c.1.10.4 (B:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme}
lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
gnqslesgeplaygksitdacigwedtdallrqlanavkarrg

SCOP Domain Coordinates for d1gg1b_:

Click to download the PDB-style file with coordinates for d1gg1b_.
(The format of our PDB-style files is described here.)

Timeline for d1gg1b_: