SCOP 1.59: Domain d1gg1b_: 1gg1 B:

Lineage for d1gg1b_ (1gg1 B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)

4. Superfamily c.1.10: Aldolase [51569] (4 families)

5. Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)

6. Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (1 species)

7. Species Escherichia coli [TaxId:562] [51601] (2 PDB entries)

8. Domain d1gg1b_: 1gg1 B: [29188]

Details for d1gg1b_

PDB Entry: 1gg1, 2 Å

PDB Description: crystal structure analysis of dahp synthase in complex with mn2+ and 2-phosphoglycolate

SCOP Domain Sequences for d1gg1b_:

Sequence; same for both SEQRES and ATOM records:

>d1gg1b_ c.1.10.4 (B:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli}
lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
gnqslesgeplaygksitdacigwedtdallrqlanavkarrg

Timeline for d1gg1b_:

• d1gg1b_ first appeared (with stable ids) in SCOP 1.55
  
• d1gg1b_ appears in SCOP 1.57
  
• d1gg1b_ appears in SCOP 1.61
  
• d1gg1b_ appears in the current release, SCOPe 2.08