SCOPe 2.06: Domain d3ejxf1: 3ejx F:11-158

Lineage for d3ejxf1 (3ejx F:11-158)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
   automatically mapped to Pfam PF01678

6. Protein Diaminopimelate epimerase [54508] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267831] (2 PDB entries)

8. Domain d3ejxf1: 3ejx F:11-158 [291875]
   Other proteins in same PDB: d3ejxb3
   automated match to d3ejxa1
   complexed with zdp

Details for d3ejxf1

PDB Entry: 3ejx, 1.95 Å

PDB Description: Crystal structure of diaminopimelate epimerase from Arabidopsis thaliana in complex with LL-AziDAP

PDB Compounds: (F:) Diaminopimelate epimerase, chloroplastic

SCOPe Domain Sequences for d3ejxf1:

Sequence; same for both SEQRES and ATOM records:

>d3ejxf1 d.21.1.1 (F:11-158) Diaminopimelate epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ekfspasfldkketgvlhfvkyhglgndfilvdnrdssepkitqeqaaklcdrnfgvgad
gvifampgvngtdyamrifnsdgsepemcgngvrcfarfiaelenlqgkhsftihtgagl
ivpeiqddgqvkvdmgtpilkaqdvptk

Timeline for d3ejxf1:

• d3ejxf1 is new in SCOPe 2.06-stable
  
• d3ejxf1 appears in SCOPe 2.07
  
• d3ejxf1 appears in the current release, SCOPe 2.08