SCOPe 2.05: Domain d1b4ea_: 1b4e A:

Lineage for d1b4ea_ (1b4e A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
   hybrid of classes I and II aldolase
   automatically mapped to Pfam PF00490

6. Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)

7. Species Escherichia coli [TaxId:562] [51598] (4 PDB entries)

8. Domain d1b4ea_: 1b4e A: [29186]
   complexed with gol, shf, so4, zn

Details for d1b4ea_

PDB Entry: 1b4e, 2 Å

PDB Description: x-ray structure of 5-aminolevulinic acid dehydratase complexed with the inhibitor levulinic acid

PDB Compounds: (A:) protein (5-aminolevulinic acid dehydratase)

SCOPe Domain Sequences for d1b4ea_:

Sequence; same for both SEQRES and ATOM records:

>d1b4ea_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]}
tdlsqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
ceytshghcgvlkehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
kragadlifsyfaldlaekkilr

Timeline for d1b4ea_:

• d1b4ea_ first appeared (with stable ids) in SCOP 1.55
  
• d1b4ea_ appears in SCOPe 2.04
  
• d1b4ea_ appears in SCOPe 2.06
  
• d1b4ea_ appears in the current release, SCOPe 2.08