Lineage for d1b4ea_ (1b4e A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 306689Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 306897Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
    hybrid of classes I and II aldolase
  6. 306898Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species)
  7. 306911Species Escherichia coli [TaxId:562] [51598] (4 PDB entries)
  8. 306914Domain d1b4ea_: 1b4e A: [29186]

Details for d1b4ea_

PDB Entry: 1b4e (more details), 2 Å

PDB Description: x-ray structure of 5-aminolevulinic acid dehydratase complexed with the inhibitor levulinic acid

SCOP Domain Sequences for d1b4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ea_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli}
tdlsqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
ceytshghcgvlkehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
kragadlifsyfaldlaekkilr

SCOP Domain Coordinates for d1b4ea_:

Click to download the PDB-style file with coordinates for d1b4ea_.
(The format of our PDB-style files is described here.)

Timeline for d1b4ea_: