Lineage for d1b4kb_ (1b4k B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086002Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 protein domains)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2086003Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 2086035Species Pseudomonas aeruginosa [TaxId:287] [51597] (2 PDB entries)
  8. 2086039Domain d1b4kb_: 1b4k B: [29185]
    complexed with mg, shf, so4

Details for d1b4kb_

PDB Entry: 1b4k (more details), 1.67 Å

PDB Description: High resolution crystal structure of a MG2-dependent 5-aminolevulinic acid dehydratase
PDB Compounds: (B:) protein (5-aminolevulinic acid dehydratase)

SCOPe Domain Sequences for d1b4kb_:

Sequence, based on SEQRES records: (download)

>d1b4kb_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]}
anraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsi
dqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgii
tdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigai
realesaghtnvrimaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhe
vaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesv
ilesltafkragadgiltyfakqaaeqlrr

Sequence, based on observed residues (ATOM records): (download)

>d1b4kb_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]}
anraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsi
dqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgii
tdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigai
realesaghtnvrimaysakyasayygpfrdavgstyqmdpansdealhevaadlaegad
mvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvilesltafkr
agadgiltyfakqaaeqlrr

SCOPe Domain Coordinates for d1b4kb_:

Click to download the PDB-style file with coordinates for d1b4kb_.
(The format of our PDB-style files is described here.)

Timeline for d1b4kb_: