![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267816] (20 PDB entries) |
![]() | Domain d3ei5b1: 3ei5 B:19-426 [291844] Other proteins in same PDB: d3ei5b2 automated match to d3ei5a_ complexed with gol, pgu, so4 |
PDB Entry: 3ei5 (more details), 2.05 Å
SCOPe Domain Sequences for d3ei5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ei5b1 c.67.1.0 (B:19-426) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} eyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvislgigdttepipevitsam akkahelstiegysgygaeqgakplraaiaktfygglgigdddvfvsdgakcdisrlqvm fgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygnieymrctpengffpdlstvgr tdiiffcspnnptgaaatreqltqlvefakkngsiivydsayamymsddnprsifeipga eevametasfskyagftgvrlgwtvipkkllysdgfpvakdfnriictcfngasnisqag alacltpegleamhkvigfykentniiidtftslgydvyggknapyvwvhfpnqsswdvf aeilekthvvttpgsgfgpggegfvrvsafghrenileacrrfkqlyk
Timeline for d3ei5b1: