Lineage for d1b4ka_ (1b4k A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 306689Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 306897Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
    hybrid of classes I and II aldolase
  6. 306898Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species)
  7. 306922Species Pseudomonas aeruginosa [TaxId:287] [51597] (2 PDB entries)
  8. 306925Domain d1b4ka_: 1b4k A: [29184]

Details for d1b4ka_

PDB Entry: 1b4k (more details), 1.67 Å

PDB Description: High resolution crystal structure of a MG2-dependent 5-aminolevulinic acid dehydratase

SCOP Domain Sequences for d1b4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ka_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa}
ypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsidqll
ieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiitdva
ldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigaireal
esaghtnvrimaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhevaad
laegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesviles
ltafkragadgiltyfakqaaeqlrr

SCOP Domain Coordinates for d1b4ka_:

Click to download the PDB-style file with coordinates for d1b4ka_.
(The format of our PDB-style files is described here.)

Timeline for d1b4ka_: