Lineage for d1aw5__ (1aw5 -)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 306689Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 306897Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
    hybrid of classes I and II aldolase
  6. 306898Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species)
  7. 306899Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51596] (11 PDB entries)
  8. 306908Domain d1aw5__: 1aw5 - [29181]
    complexed with zn; mutant

Details for d1aw5__

PDB Entry: 1aw5 (more details), 2.3 Å

PDB Description: 5-aminolevulinate dehydratase from saccharomyces cerevisiae

SCOP Domain Sequences for d1aw5__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw5__ c.1.10.3 (-) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae)}
mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsa
pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgirfir
ekfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
midgrirdikrglinanlahktfvlsyaakfsgnlygpacyqlppagrglarralerdms
egadgiivkpstfyldivrdaseickdlpicayhvsgeyamlhaaaekgvvdlktiafes
hqgflragarliitylapefldwlde

SCOP Domain Coordinates for d1aw5__:

Click to download the PDB-style file with coordinates for d1aw5__.
(The format of our PDB-style files is described here.)

Timeline for d1aw5__: