Lineage for d1ylva_ (1ylv A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475345Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 475641Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
    hybrid of classes I and II aldolase
  6. 475642Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 475643Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51596] (11 PDB entries)
  8. 475650Domain d1ylva_: 1ylv A: [29180]

Details for d1ylva_

PDB Entry: 1ylv (more details), 2.15 Å

PDB Description: schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with laevulinic acid

SCOP Domain Sequences for d1ylva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylva_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae)}
mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
ekfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
ekgvvdlktiafeshtgflragarliitylapefldwldee

SCOP Domain Coordinates for d1ylva_:

Click to download the PDB-style file with coordinates for d1ylva_.
(The format of our PDB-style files is described here.)

Timeline for d1ylva_: