Lineage for d1b57b_ (1b57 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65283Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 65428Family c.1.10.2: Class II aldolase [51591] (1 protein)
  6. 65429Protein Fructose-bisphosphate aldolase [51592] (1 species)
  7. 65430Species Escherichia coli [TaxId:562] [51593] (3 PDB entries)
  8. 65434Domain d1b57b_: 1b57 B: [29178]

Details for d1b57b_

PDB Entry: 1b57 (more details), 2 Å

PDB Description: class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate

SCOP Domain Sequences for d1b57b_:

Sequence, based on SEQRES records: (download)

>d1b57b_ c.1.10.2 (B:) Fructose-bisphosphate aldolase {Escherichia coli}
skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl

Sequence, based on observed residues (ATOM records): (download)

>d1b57b_ c.1.10.2 (B:) Fructose-bisphosphate aldolase {Escherichia coli}
skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
eelytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltptilrdsqeyvskkh
nlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqg
qlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl

SCOP Domain Coordinates for d1b57b_:

Click to download the PDB-style file with coordinates for d1b57b_.
(The format of our PDB-style files is described here.)

Timeline for d1b57b_: